PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9NG478100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 644aa    MW: 67065.9 Da    PI: 6.5096
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9NG478100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS281.82e-862846422374
                 GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                          ve+L e+A+  ++gd+  a+++Larl+ +   a  +g+p+ R a+yf+eAL+  l+     + +a +p  +++++++ +l a+k+fsevs
  Pavir.9NG478100.1.p 284 VEQLAEAAKLAEAGDAFGAREILARLNYRlpaAPAAGTPLLRSAFYFKEALRLALSP----TGEAPAPPVSTPYDVVLKLGAYKAFSEVS 369
                          789*************************999455566******************99....77778788888899*************** PP

                 GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                          P+l+f+hlt+ qa+l+++ g+ r+H++Dfdi++G QW++L+q+La+R  ++++l++T+++sp++++  el+ ++e+La fA+elgv ++ 
  Pavir.9NG478100.1.p 370 PVLQFAHLTCVQAVLDEIGGAGRIHVLDFDIGMGEQWASLMQELAQR-CPAATLKVTALVSPATHHPLELQLIHENLAGFAAELGVFLQL 458
                          **********************************************9.7889************************************** PP

                 GRAS 179 nvlvakrledleleeL.rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                           v+   ++++l++ eL ++ +g+a+aV+l +   ++         + ++vL+lvk+l +kvv+ v++  d+++ +F++++++a++ +++l
  Pavir.9NG478100.1.p 459 AVF---NIDTLDPAELvAITSGDAVAVHLPVGSAHVA--------AMPAVLRLVKRLGAKVVISVDHGGDRTELPFAAHLFQAFQSCVSL 537
                          *98...999999999945566***********99998........4566***************************************** PP

                 GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgs 357
                          ++s++a   +++++ +k+Er+l+++ ++  v +++++  +  +    Wr  l +aGF pv+ s++a++qa++ll++++  g+rve++ g+
  Pavir.9NG478100.1.p 538 LESVDAV-RPDADAVAKMERFLVQPGVERRVVARHRA-AAMDKPPLPWRTVLASAGFVPVQASTFAESQAEALLKRMALMGFRVEKRGGA 625
                          ****998.6788999**************99999998.666777889******************************************* PP

                 GRAS 358 lvlgWkdrpLvsvSaWr 374
                          l+l+W++ +LvsvSaWr
  Pavir.9NG478100.1.p 626 LCLYWQRGELVSVSAWR 642
                          ****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.676257622IPR005202Transcription factor GRAS
PfamPF035146.8E-84284642IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MRGMLFAGSA REGHAGTLLL LQQQQQQGLA AGKVSGVGGL WEPTSVLDQR HSPSPSPPTS  60
ASTLSSPLGA ATAGVAALAG ANAKNVSPPP QAAAWPGGAA AEEAAVGGKE EWQLTPLDMG  120
LGAGEGWDAA GSVLSDGAAP PGLAPDHTFL RWIIGGEDAS VGMGAVMDPP VLELDHAPSM  180
MSPAFGSNMP FAPAMEDTKA PLFGHASNLL LHHHQHHPQP HAAFFGSHPS FDAAPPTPKR  240
HHPMAPAPAP KLQSLPGPAA PAGRFVPAMK PKAEAANDEA AAAVEQLAEA AKLAEAGDAF  300
GAREILARLN YRLPAAPAAG TPLLRSAFYF KEALRLALSP TGEAPAPPVS TPYDVVLKLG  360
AYKAFSEVSP VLQFAHLTCV QAVLDEIGGA GRIHVLDFDI GMGEQWASLM QELAQRCPAA  420
TLKVTALVSP ATHHPLELQL IHENLAGFAA ELGVFLQLAV FNIDTLDPAE LVAITSGDAV  480
AVHLPVGSAH VAAMPAVLRL VKRLGAKVVI SVDHGGDRTE LPFAAHLFQA FQSCVSLLES  540
VDAVRPDADA VAKMERFLVQ PGVERRVVAR HRAAAMDKPP LPWRTVLASA GFVPVQASTF  600
AESQAEALLK RMALMGFRVE KRGGALCLYW QRGELVSVSA WRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-2631564232375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.42270.0callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277570.0KJ727757.1 Zea mays clone pUT5701 GRAS transcription factor (GRAS33) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983723.10.0PREDICTED: scarecrow-like protein 6 isoform X1
TrEMBLK4AJM70.0K4AJM7_SETIT; Uncharacterized protein
STRINGSi039098m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.14e-79GRAS family protein